PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009588686.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 371aa    MW: 42214.4 Da    PI: 6.6022
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009588686.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.91.5e-151462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+ ++ q+G+g +W + + ++g++R++k+c++rw++yl
   XP_009588686.1 14 KGPWSPEEDAKLKSYIDQHGTGgNWIALPPKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding38.42.8e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd +++ +    G++ W+ Ia+ ++ gRt++++k++w++
   XP_009588686.1  69 GGFSQEEDNIILSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.131962IPR017930Myb domain
SuperFamilySSF466897.35E-2611109IPR009057Homeodomain-like
SMARTSM007179.9E-121364IPR001005SANT/Myb domain
PfamPF002492.0E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-231569IPR009057Homeodomain-like
CDDcd001672.51E-81662No hitNo description
PROSITE profilePS5129421.58263117IPR017930Myb domain
SMARTSM007171.3E-1167115IPR001005SANT/Myb domain
PfamPF002497.1E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-2370117IPR009057Homeodomain-like
CDDcd001672.13E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MGRAPCCDKN SVKKGPWSPE EDAKLKSYID QHGTGGNWIA LPPKIGLKRC GKSCRLRWLN  60
YLRPNLKHGG FSQEEDNIIL SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLFGK  120
QRKNLRGKSQ KQGSRKGRDQ MNSSMDSNNN INTNPSWSEF PILQQIPYSN DEPRYSNDHT  180
SIRMLLMKLG GKFYDDDDDD KPMNGALNPQ YDPMDNSLMH PLYHNSINLM SSAPMGVMNT  240
MNSPFTNSHE YNVEGKAVCW VDTDTEKQKL RERMGSDTSV VLALNDGCNS TAELEHMVYT  300
DTQKLDDLEM LYEDMLNNKP STTLGGNLDW EDMNNLVFPF PPLVVSNNEG HQHGTLLEEG  360
ALNELRYPRD Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-23141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009588686.10.0PREDICTED: transcription factor RAX3-like
RefseqXP_016503727.10.0PREDICTED: transcription factor RAX3-like
TrEMBLM1A1M31e-136M1A1M3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000127021e-136(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.11e-72myb domain protein 36